PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID snap_masked-scaffold01056-abinit-gene-0.13-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NF-YB
Protein Properties Length: 138aa    MW: 15447.3 Da    PI: 4.8665
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
snap_masked-scaffold01056-abinit-gene-0.13-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB184.67.7e-5819114297
                                              NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrkt 61 
                                                        reqdrflPianvsrimk++lPanakisk+aketvqecvsefisf+t+easdkcqrekrkt
  snap_masked-scaffold01056-abinit-gene-0.13-mRNA-1  19 REQDRFLPIANVSRIMKRALPANAKISKEAKETVQECVSEFISFITGEASDKCQREKRKT 78 
                                                        89********************************************************** PP

                                              NF-YB  62 ingddllwalatlGfedyveplkvylkkyrelegek 97 
                                                        ingddllwa++tlGfe+yveplk+yl+k+re+ege+
  snap_masked-scaffold01056-abinit-gene-0.13-mRNA-1  79 INGDDLLWAMTTLGFEEYVEPLKIYLQKFREMEGER 114
                                                        **********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.0E-5513118IPR009072Histone-fold
SuperFamilySSF471139.01E-4121118IPR009072Histone-fold
PfamPF008089.3E-282488IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006158.4E-225270No hitNo description
PROSITE patternPS0068505571IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006158.4E-227189No hitNo description
PRINTSPR006158.4E-2290108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 138 aa     Download sequence    Send to blast
MADSDNDSGG QNNTNLSPRE QDRFLPIANV SRIMKRALPA NAKISKEAKE TVQECVSEFI  60
SFITGEASDK CQREKRKTIN GDDLLWAMTT LGFEEYVEPL KIYLQKFREM EGERSTAAMG  120
GRHGDGRDGI GDDKQVML
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-4819109292Transcription factor HapC (Eurofung)
4g92_B2e-4819109292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002323121.22e-76hypothetical protein POPTR_0016s00780g
SwissprotO233107e-75NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLB9IH152e-76B9IH15_POPTR; Uncharacterized protein
STRINGPOPTR_0016s00780.15e-76(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.11e-75nuclear factor Y, subunit B3